Novus Biologicals
Manufacturer Code:NBP15734220UL
Catalog # NBP15734220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DDX48 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 48) The peptide sequence was selected from the middle region of DDX48. Peptide sequence QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP-dependent RNA helicase DDX48; ATP-dependent RNA helicase DDX48 ATP-dependent RNA helicase eIF4A-3 DDX48 DEAD (Asp-Glu-Ala-Asp) box polypeptide 48 DEAD box protein 48 DKFZp686O16189 EC 3.6.1 EC 3.6.4.13 eIF-4A-III eIF4A-III EIF4AIII eukaryotic initiation factor 4A-III Eukaryotic initiation factor 4A-like NUK-34 eukaryotic translation initiation factor 4A Eukaryotic translation initiation factor 4A isoform 3 eukaryotic translation initiation factor 4A3 hNMP 265 KIAA0111eukaryotic translation initiation factor 4A isoform 3 MGC10862 NMP 265 NMP265 Nuclear matrix protein 265 NUK34; ATP-dependent RNA helicase eIF4A-3; DEAD (Asp-Glu-Ala-Asp) box polypeptide 48; DEAD box protein 48; eIF-4A-III; eIF4A-III; Eukaryotic initiation factor 4A-III; Eukaryotic initiation factor 4A-III, N-terminally processed; Eukaryotic initiation factor 4A-like NUK-34; Eukaryotic translation initiation factor 4A isoform 3; eukaryotic translation initiation factor 4A, isoform 3; hNMP 265; NMP 265; Nuclear matrix protein 265
Gene Aliases: DDX48; EIF4A3; eIF4AIII; KIAA0111; MUK34; NMP265; NUK34; RCPS
UniProt ID: (Human) P38919
Entrez Gene ID: (Human) 9775
Molecular Function:
RNA binding protein
RNA helicase
helicase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.