Novus Biologicals
Manufacturer Code:NBP247475
Catalog # NBP247475
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELRTALTTTISSRD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 5.3.1.23 M1Pi Mediator of RhoA-dependent invasion methylthioribose-1-phosphate isomerase methylthioribose-1-phosphate isomerase homolog (S. cerevisiae) MGC3207 MRDI MTNA MTR-1-P isomerase S-methyl-5-thioribose-1-phosphate isomerase Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein Ypr118w; M1Pi; Mediator of RhoA-dependent invasion; Methylthioribose-1-phosphate isomerase; methylthioribose-1-phosphate isomerase homolog; MRI1; MTR-1-P isomerase; S-methyl-5-thioribose-1-phosphate isomerase; S-methyl-5-thioribose-1-phosphate isomerase 1; Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein
Gene Aliases: MRDI; MRI1; MTNA; UNQ6390/PRO21135; Ypr118w
UniProt ID: (Human) Q9BV20
Entrez Gene ID: (Human) 84245
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.