Novus Biologicals
Manufacturer Code:NBP256101
Catalog # NBP256101
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AT225; AT225Transcription factor ETR103 early growth response 1 early growth response protein 1 EGR-1 G0S30 KROX24 KROX-24 Nerve growth factor-induced protein A NGFI-ATranscription factor Zif268 TIS8 ZIF-268 Zinc finger protein Krox-24 ZNF225Zinc finger protein 225; Early growth response protein 1; EGR-1; Nerve growth factor-induced protein A; NGFI-A; Transcription factor ETR103; Transcription factor Zif268; Zinc finger protein 225; Zinc finger protein Krox-24
Gene Aliases: AT225; EGR1; G0S30; KROX-24; KROX24; NGFI-A; TIS8; ZIF-268; ZNF225
UniProt ID: (Human) P18146
Entrez Gene ID: (Human) 1958
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.