Novus Biologicals
Manufacturer Code:NBP154943
Catalog # NBP154943
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EGLN3(egl nine homolog 3 (C. elegans)) The peptide sequence was selected from the C terminal of EGLN3 (NP_071356). Peptide sequence FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: EC 1.14.11 EC 1.14.11.- EGL nine (C.elegans) homolog 3 egl nine homolog 3 egl nine homolog 3 (C. elegans) egl nine-like protein 3 isoform FLJ21620 HIF prolyl hydroxylase 3 HIF-PH3 HIFPH3 MGC125998 HIF-prolyl hydroxylase 3 HPH-1 HPH-3 Hypoxia-inducible factor prolyl hydroxylase 3 MGC125999 pdh3 PHD3 Prolyl hydroxylase domain-containing protein 3; Egl nine homolog 3; egl nine-like protein 3 isoform; egl-9 family hypoxia-inducible factor 3; HIF prolyl hydroxylase 3; HIF-PH3; HIF-prolyl hydroxylase 3; HPH-1; HPH-3; Hypoxia-inducible factor prolyl hydroxylase 3; PHD3; Prolyl hydroxylase domain-containing protein 3; Prolyl hydroxylase EGLN3
Gene Aliases: EGLN3; HIFP4H3; HIFPH3; PHD3
UniProt ID: (Human) Q9H6Z9
Entrez Gene ID: (Human) 112399
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.