Novus Biologicals
Manufacturer Code:NBP258790
Catalog # NBP258790
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFDYLLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQDEPRYMMLAREAEMLFTG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase; Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase calcium/calmodulin-dependent eukaryotic elongation factor-2 kinase EC 2.7.11 EC 2.7.11.20 eEF-2 kinase eEF-2Kcalmodulin-dependent protein kinase III elongation factor-2 kinase eukaroytic elongation factor 2 kinase eukaryotic elongation factor 2 kinase eukaryotic elongation factor-2 kinase HSU93850 MGC45041; calcium/calmodulin-dependent eukaryotic elongation factor-2 kinase; calmodulin-dependent protein kinase III; eEF-2 kinase; elongation factor-2 kinase; eukaroytic elongation factor 2 kinase; Eukaryotic elongation factor 2 kinase; eukaryotic elongation factor-2 kinase
Gene Aliases: eEF-2K; EEF2K; HSU93850
UniProt ID: (Human) O00418
Entrez Gene ID: (Human) 29904
Molecular Function: Hsp70 family chaperone chaperone kinase non-receptor serine/threonine protein kinase protein kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.