Novus Biologicals
Manufacturer Code:NBP255640
Catalog # NBP255640
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AIMP3Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3 ARS-interacting multifunctional protein 3 Elongation factor p18 eukaryotic translation elongation factor 1 epsilon 1 eukaryotic translation elongation factor 1 epsilon-1 Multisynthase complex auxiliary component p18 P18 p18 component of aminoacyl-tRNA synthetase complex; Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; ARS-interacting multifunctional protein 3; Elongation factor p18; Eukaryotic translation elongation factor 1 epsilon-1; Multisynthase complex auxiliary component p18; p18 component of aminoacyl-tRNA synthetase complex
Gene Aliases: AIMP3; EEF1E1; P18
UniProt ID: (Human) O43324
Entrez Gene ID: (Human) 9521
Molecular Function:
RNA binding protein
cytoskeletal protein
epimerase/racemase
isomerase
nucleic acid binding
oxidoreductase
reductase
signaling molecule
transferase
translation elongation factor
translation factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.