Novus Biologicals
Manufacturer Code:NBP237921
Catalog # NBP237921
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FDPTNFIHNNGSTFDAVITPYGECILGAGGYIFNTEAHPIDPAALHCCQRLKEEQWEVEDLMREFYSLKRSRSKFQKNTVSSGPWEPPARPGTLFSP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA4204.1 C20orf31 C20orf49 chromosome 20 open reading frame 31 ER degradation enhancer mannosidase alpha-like 2 ER degradation-enhancing alpha-mannosidase-like 2 ER degradation-enhancing-mannosidase-like protein 2 FLJ10783; ER degradation enhancer, mannosidase alpha-like 2; ER degradation-enhancing alpha-mannosidase-like 2; ER degradation-enhancing alpha-mannosidase-like protein 2; ER degradation-enhancing-mannosidase-like protein 2
Gene Aliases: bA4204.1; C20orf31; C20orf49; EDEM2; UNQ573/PRO1135
UniProt ID: (Human) Q9BV94
Entrez Gene ID: (Human) 55741
Molecular Function: chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.