Novus Biologicals
Manufacturer Code:NBP159963
Catalog # NBP159963
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EDEM1(ER degradation enhancer mannosidase alpha-like 1) The peptide sequence was selected from the N terminal of EDEM1. Peptide sequence MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EDEMKIAA0212ER degradation-enhancing alpha-mannosidase-like 1 ER degradation enhancer mannosidase alpha-like 1 FLJ51559 FLJ51560; ER degradation enhancer, mannosidase alpha-like 1; ER degradation-enhancing alpha-mannosidase-like 1; ER degradation-enhancing alpha-mannosidase-like protein 1
Gene Aliases: EDEM; EDEM1; KIAA0212
UniProt ID: (Human) Q92611
Entrez Gene ID: (Human) 9695
Molecular Function: chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.