Novus Biologicals
Manufacturer Code:NBP180537
Catalog # NBP180537
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human EDA. Peptide sequence HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Ectodermal dysplasia protein; ectodysplasin A ED1; Ectodysplasin-A; Ectodysplasin-A, membrane form; Ectodysplasin-A, secreted form; EDA protein; oligodontia 1; tumor necrosis factor ligand 7C; X-linked anhidroitic ectodermal dysplasia protein
Gene Aliases: ECTD1; ED1; ED1-A1; ED1-A2; EDA; EDA-A1; EDA-A2; EDA1; EDA2; HED; HED1; ODT1; STHAGX1; TNLG7C; XHED; XLHED
UniProt ID: (Human) Q92838
Entrez Gene ID: (Human) 1896
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.