Novus Biologicals
Manufacturer Code:NBP159782
Catalog # NBP159782
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EBP(emopamil binding protein (sterol isomerase)) The peptide sequence was selected from the N terminal of EBP. Peptide sequence LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-beta-hydroxysteroid-Delta(8) CDPX2 Cholestenol Delta-isomerase CPX3-beta-hydroxysteroid-delta-8 CPXDX-linked dominant (Happle syndrome) D8-D7 sterol isomerase Delta(7)-isomerase Delta(8)-Delta(7) sterol isomerase delta-7-isomerase EC 5.3.3.5 emopamil binding protein (sterol isomerase) Emopamil-binding protein sterol 8-isomerase; 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; 3-beta-hydroxysteroid-delta-8,delta-7-isomerase; Cholestenol Delta-isomerase; Chondrodysplasia punctata-2, X-linked dominant (Happle syndrome); D8-D7 sterol isomerase; Delta(8)-Delta(7) sterol isomerase; Emopamil-binding protein; sterol 8-isomerase
Gene Aliases: CDPX2; CHO2; CPX; CPXD; EBP; MEND
UniProt ID: (Human) Q15125
Entrez Gene ID: (Human) 10682
Molecular Function:
isomerase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.