Novus Biologicals
Manufacturer Code:NBP162519
Catalog # NBP162519
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for anti-SLC1A1 antibody: synthetic peptide directed towards the N terminal of human SLC1A1 (NP_004161). Peptide sequence VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EAAC1excitatory amino acid carrier 1 EAAT3excitatory amino acid transporter 3 Excitatory amino-acid carrier 1 Neuronal and epithelial glutamate transporter Sodium-dependent glutamate/aspartate transporter 3 solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter system Xag) member 1 Solute carrier family 1 member 1; excitatory amino acid carrier 1; Excitatory amino acid transporter 3; Excitatory amino-acid carrier 1; Neuronal and epithelial glutamate transporter; Sodium-dependent glutamate/aspartate transporter 3; solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1; Solute carrier family 1 member 1
Gene Aliases: DCBXA; EAAC1; EAAT3; SCZD18; SLC1A1
UniProt ID: (Human) P43005
Entrez Gene ID: (Human) 6505
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.