Novus Biologicals
Manufacturer Code:NBP159633
Catalog # NBP159633
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC1A2(solute carrier family 1 (glial high affinity glutamate transporter) member 2) The peptide sequence was selected from the middle region of SLC1A2. Peptide sequence LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Excitatory amino acid transporter 2; excitotoxic amino acid transporter 2; GLT1 member 2 solute carrier family 1 (glial high affinity glutamate transporter) member 2 Solute carrier family 1 member 2; Glutamate/aspartate transporter II; Sodium-dependent glutamate/aspartate transporter 2; solute carrier family 1 (glial high affinity glutamate transporter), member 2; Solute carrier family 1 member 2
Gene Aliases: EAAT2; GLT-1; GLT1; HBGT; SLC1A2
UniProt ID: (Human) P43004
Entrez Gene ID: (Human) 6506
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.