Novus Biologicals
Manufacturer Code:NBP184939
Catalog # NBP184939
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EA6FLJ25094 EAAT1GLAST-1 excitatory amino acid transporter 1 GLASTGLAST1 Sodium-dependent glutamate/aspartate transporter 1 solute carrier family 1 (glial high affinity glutamate transporter) member 3 Solute carrier family 1 member 3; Excitatory amino acid transporter 1; GLAST-1; Sodium-dependent glutamate/aspartate transporter 1; solute carrier family 1 (glial high affinity glutamate transporter), member 3; Solute carrier family 1 member 3
Gene Aliases: EA6; EAAT1; GLAST; GLAST1; SLC1A3
UniProt ID: (Human) P43003
Entrez Gene ID: (Human) 6507
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.