Novus Biologicals
Manufacturer Code:NBP189092
Catalog # NBP189092
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ANCREPVE6AP AS CTCL tumor antigen se37-2 E6AP E6-AP E6AP ubiquitin-protein ligase EC 6.3.2.- FLJ26981 HPVE6A human papilloma virus E6-associated protein Human papillomavirus E6-associated protein Oncogenic protein-associated protein E6-AP Renal carcinoma antigen NY-REN-54 ubiquitin protein ligase E3A ubiquitin-protein ligase E3A; CTCL tumor antigen se37-2; E6AP ubiquitin-protein ligase; HECT-type ubiquitin transferase E3A; human papilloma virus E6-associated protein; Human papillomavirus E6-associated protein; Oncogenic protein-associated protein E6-AP; Renal carcinoma antigen NY-REN-54; Ubiquitin-protein ligase E3A
Gene Aliases: ANCR; AS; E6-AP; E6AP; EPVE6AP; HPVE6A; UBE3A
UniProt ID: (Human) Q05086
Entrez Gene ID: (Human) 7337
Molecular Function: ligase ubiquitin-protein ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.