Novus Biologicals
Manufacturer Code:NBP16901720UL
Catalog # NBP16901720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to Dag1 (dystroglycan 1) The peptide sequence was selected from the C terminal of Dag1. Peptide sequence PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: A3a AGRNR DAG156DAG dystroglycan dystroglycan 1 (dystrophin-associated glycoprotein 1) Dystrophin-associated glycoprotein 1; Alpha-DG; Alpha-dystroglycan; Beta-DG; Beta-dystroglycan; Dystroglycan; dystroglycan 1 (dystrophin-associated glycoprotein 1); Dystrophin-associated glycoprotein 1
Gene Aliases: 156DAG; A3a; AGRNR; DAG; DAG1; MDDGA9; MDDGC7; MDDGC9
UniProt ID: (Human) Q14118
Entrez Gene ID: (Human) 1605
Molecular Function:
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.