Novus Biologicals
Manufacturer Code:NBP158317
Catalog # NBP158317
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DVL1(dishevelled dsh homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of DVL1. Peptide sequence LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dishevelled 1 (homologous to Drosophila dsh); dishevelled 1 (homologous to Drosophila dsh) dishevelled dsh homolog 1 (Drosophila) Dishevelled-1 DSH homolog 1 DVL DVL1L1 MGC54245 segment polarity protein dishevelled homolog DVL-1; dishevelled, dsh homolog 1; Dishevelled-1; DSH homolog 1; Segment polarity protein dishevelled homolog DVL-1
Gene Aliases: DRS2; DVL; DVL1; DVL1L1; DVL1P1
UniProt ID: (Human) O14640
Entrez Gene ID: (Human) 1855
Molecular Function:
enzyme modulator
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.