Novus Biologicals
Manufacturer Code:NBP213845
Catalog # NBP213845
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCP PNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Beta-glucan receptor; Beta-glucan receptor BGR CLECSF12DC-associated C-type lectin 1 C-type (calcium dependent carbohydrate-recognition domain) lectin superfamilymember 12 C-type lectin domain family 7 member A C-type lectin domain family 7 member A C-type lectin superfamily member 12 dectin-1 DECTIN1CANDF4 Dendritic cell-associated C-type lectin 1 dendritic cell-associated C-type lectin-1 hDectin-1 lectin-like receptor 1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12; C-type lectin domain family 7 member A; C-type lectin domain family 7, member A; C-type lectin superfamily member 12; CD369; DC-associated C-type lectin 1; dectin-1; Dendritic cell-associated C-type lectin 1; dendritic cell-associated C-type lectin-1; lectin-like receptor 1
Gene Aliases: BGR; CANDF4; CD369; CLEC7A; CLECSF12; DECTIN1; SCARE2; UNQ539/PRO1082
UniProt ID: (Human) Q9BXN2
Entrez Gene ID: (Human) 64581
Molecular Function:
membrane-bound signaling molecule
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.