Novus Biologicals
Manufacturer Code:NBP157923
Catalog # NBP157923
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DCN(decorin) The peptide sequence was selected from the N terminal of DCN. Peptide sequence IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Bone proteoglycan II; Bone proteoglycan II CSCD decorin decorin proteoglycan dermatan sulphate proteoglycans II DSPG2 PG40 PGII PG-S2 proteoglycan core protein SLRR1BPGS2 small leucine-rich protein 1B; Decorin; dermatan sulphate proteoglycans II; PG-S2; PG40; proteoglycan core protein; small leucine-rich protein 1B
Gene Aliases: CSCD; DCN; DSPG2; PG40; PGII; PGS2; SLRR1B
UniProt ID: (Human) P07585
Entrez Gene ID: (Human) 1634
Molecular Function:
cytokine
extracellular matrix protein
receptor
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.