Novus Biologicals
Manufacturer Code:NBP231587
Catalog # NBP231587
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DAZ interacting protein 1; DAZ interacting protein 1 DAZ-interacting protein 1/2 DZIP DZIP2 DZIPDAZ interacting protein testis1 DZIPt1 KIAA0996zinc finger DAZ interacting protein 1 RP11-23E3.3 zinc finger protein DZIP1 zinc-finger protein DZIPt1; DAZ interacting protein testis1; DAZ-interacting protein 1/2; zinc finger DAZ interacting protein 1; Zinc finger protein DZIP1; zinc-finger protein DZIPt1
Gene Aliases: DZIP; DZIP1; DZIP2; DZIPt1; KIAA0996
UniProt ID: (Human) Q86YF9
Entrez Gene ID: (Human) 22873
Molecular Function:
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.