Novus Biologicals
Manufacturer Code:NBP238437
Catalog # NBP238437
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LLSETLDLSELFHPDTFLNALRQETARAVGRSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNQLSENQLDSPSVSSVLPCFMGWIPQDA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATD3 DHC1B DHC2 DNCH2 DYH1B dynein cytoplasmic heavy chain 2 dynein heavy chain 11 dynein cytoplasmic 2 heavy chain 1 dynein cytoplasmic heavy polypeptide 2 FLJ11756 hdhc11 isotype 1B KIAA1997; Cytoplasmic dynein 2 heavy chain; Cytoplasmic dynein 2 heavy chain 1; Dynein cytoplasmic heavy chain 2; Dynein heavy chain 11; Dynein heavy chain isotype 1B; dynein heavy chain, isotype 1B; dynein, cytoplasmic 2, heavy chain 1; dynein, cytoplasmic, heavy polypeptide 2; hDHC11
Gene Aliases: ATD3; DHC1B; DHC2; DNCH2; DYH1B; DYNC2H1; hdhc11; KIAA1997; SRPS2B; SRTD3
UniProt ID: (Human) Q8NCM8
Entrez Gene ID: (Human) 79659
Molecular Function: cytoskeletal protein hydrolase microtubule binding motor protein microtubule family cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.