Novus Biologicals
Manufacturer Code:NBP233880
Catalog # NBP233880
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DSP-4; DSP-4 dual specificity phosphatase 26 (putative) Dual specificity phosphatase SKRP3 dual specificity protein phosphatase 26 dual-specificity phosphatase SKRP3 DUSP24SKRP3 EC 3.1.3.16 EC 3.1.3.48 LDP4 LDP-4 Low-molecular-mass dual-specificity phosphatase 4 MAP kinase phosphatase 8 MGC1136 MGC2627 Mitogen-activated protein kinase phosphatase 8 MKP8 MKP-8 NATA1 Novel amplified gene in thyroid anaplastic cancer; Dual specificity phosphatase SKRP3; Dual specificity protein phosphatase 26; Low-molecular-mass dual-specificity phosphatase 4; MAP kinase phosphatase 8; Mitogen-activated protein kinase phosphatase 8; neuroendocrine-associated phosphatase; Novel amplified gene in thyroid anaplastic cancer
Gene Aliases: DSP-4; DUSP24; DUSP26; LDP-4; LDP4; MKP-8; MKP8; NATA1; NEAP; SKRP3
UniProt ID: (Human) Q9BV47
Entrez Gene ID: (Human) 78986
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.