Novus Biologicals
Manufacturer Code:NBP183078
Catalog # NBP183078
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFW |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dual specificity phosphatase 22 dual specificity protein phosphatase 22 EC 3.1.3.16 EC 3.1.3.48 FLJ35864 homolog of mouse dual specificity phosphatase LMW-DSP2 JKAP JNK-stimulating phosphatase 1 JSP-1 JSP1JNK-stimulatory phosphatase-1 LMWDSP2 LMW-DSP2 Low molecular weight dual specificity phosphatase 2 Mitogen-activated protein kinase phosphatase x MKP-x MKPXMAP kinase phosphatase x VHX; Dual specificity protein phosphatase 22; homolog of mouse dual specificity phosphatase LMW-DSP2; JNK-stimulating phosphatase 1; JNK-stimulatory phosphatase-1; JSP-1; LMW-DSP2; Low molecular weight dual specificity phosphatase 2; MAP kinase phosphatase x; Mitogen-activated protein kinase phosphatase x
Gene Aliases: DUSP22; JKAP; JSP-1; JSP1; LMW-DSP2; LMWDSP2; MKP-x; MKPX; VHX
UniProt ID: (Human) Q9NRW4
Entrez Gene ID: (Human) 56940
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.