Novus Biologicals
Manufacturer Code:NBP184041
Catalog # NBP184041
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dual specificity phosphatase 19 Dual specificity phosphatase TS-DSP1 dual specificity protein phosphatase 19 DUSP17SAPK pathway-regulating phosphatase 1 EC 3.1.3.16 EC 3.1.3.48 LMWDSP3 LMW-DSP3 Low molecular weight dual specificity phosphatase 3 Protein phosphatase SKRP1 SKRP1MGC138210 Stress-activated protein kinase pathway-regulating phosphatase 1 TS-DSP1; Dual specificity phosphatase TS-DSP1; Dual specificity protein phosphatase 19; LMW-DSP3; Low molecular weight dual specificity phosphatase 3; Protein phosphatase SKRP1; SAPK pathway-regulating phosphatase 1; Stress-activated protein kinase pathway-regulating phosphatase 1
Gene Aliases: DUSP17; DUSP19; LMWDSP3; SKRP1; TS-DSP1
UniProt ID: (Human) Q8WTR2
Entrez Gene ID: (Human) 142679
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.