Novus Biologicals
Manufacturer Code:NBP233275
Catalog # NBP233275
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGMVTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTEEDIAPYIQDLCGEKQTIGALLTKYSHSSMQNGVKVYNSRRP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DCC1MGC5528 defective in sister chromatid cohesion 1 homolog (S. cerevisiae) Defective in sister chromatid cohesion protein 1 homolog hDCC1 sister chromatid cohesion protein DCC1; defective in sister chromatid cohesion 1 homolog; Defective in sister chromatid cohesion protein 1 homolog; Sister chromatid cohesion protein DCC1
Gene Aliases: DCC1; DSCC1; UNQ9337/PRO34008
UniProt ID: (Human) Q9BVC3
Entrez Gene ID: (Human) 79075
Molecular Function: DNA binding protein nucleic acid binding replication origin binding protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.