Novus Biologicals
Manufacturer Code:NBP19131620UL
Catalog # NBP19131620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human DRGX. Peptide sequence MVLMSCDQRLISLLLVGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dorsal root ganglia homeobox DRG11 paired related homeobox-like 1 paired-like homeodomain trancription factor DRG11 paired-related homeobox protein-like 1 PRRXL1; Dorsal root ganglia homeobox protein; paired related homeobox-like 1; paired-like homeodomain trancription factor DRG11; Paired-related homeobox protein-like 1
Gene Aliases: DRG11; DRGX; PRRXL1
UniProt ID: (Human) A6NNA5
Entrez Gene ID: (Human) 644168
Molecular Function: DNA binding protein helix-turn-helix transcription factor homeobox transcription factor nucleic acid binding transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.