Novus Biologicals
Manufacturer Code:NBP16219520UL
Catalog # NBP16219520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DPY19L2(dpy-19-like 2 (C. elegans)) The peptide sequence was selected form the middle region of DPY19L2. Peptide sequence IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dpy-19-like 2; dpy-19-like 2 (C. elegans) Dpy-19-like protein 2 FLJ32949 FLJ36166 protein dpy-19 homolog 2; Dpy-19-like protein 2; Probable C-mannosyltransferase DPY19L2; Protein dpy-19 homolog 2; spermatogenesis associated 34
Gene Aliases: DPY19L2; SPATA34; SPGF9; UNQ3127/PRO10284
UniProt ID: (Human) Q6NUT2
Entrez Gene ID: (Human) 283417
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.