Novus Biologicals
Manufacturer Code:NBP213935
Catalog # NBP213935
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFS ESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDGIEEC 2.4.1.83 dolichol monophosphate mannose synthase dolichol-phosphate mannosyltransferase Dolichyl-phosphate beta-D-mannosyltransferase dolichyl-phosphate mannosyltransferase polypeptide 1 catalytic subunit DPM synthase Mannose-P-dolichol synthase MPD synthase MPDSDolichol-phosphate mannose synthase; dolichol monophosphate mannose synthase; Dolichol-phosphate mannose synthase subunit 1; Dolichol-phosphate mannosyltransferase subunit 1; Dolichyl-phosphate beta-D-mannosyltransferase subunit 1; dolichyl-phosphate mannosyltransferase polypeptide 1 catalytic subunit; DPM synthase complex, catalytic subunit; DPM synthase subunit 1; Mannose-P-dolichol synthase subunit 1; MPD synthase subunit 1
Gene Aliases: CDGIE; DPM1; MPDS
UniProt ID: (Human) O60762
Entrez Gene ID: (Human) 8813
Molecular Function: glycosyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.