Novus Biologicals
Manufacturer Code:NBP15887020UL
Catalog # NBP15887020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DOCK2(dedicator of cytokinesis 2) The peptide sequence was selected from the middle region of DOCK2. Peptide sequence ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dedicator of cyto-kinesis 2; dedicator of cytokinesis 2 dedicator of cytokinesis protein 2 FLJ46592 KIAA0209dedicator of cyto-kinesis 2; Dedicator of cytokinesis protein 2
Gene Aliases: DOCK2; IMD40; KIAA0209
UniProt ID: (Human) Q92608
Entrez Gene ID: (Human) 1794
Molecular Function:
G-protein modulator
enzyme modulator
guanyl-nucleotide exchange factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.