Novus Biologicals
Manufacturer Code:NBP159404
Catalog # NBP159404
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DNASE1(deoxyribonuclease I) The peptide sequence was selected from the N terminal of DNASE1. Peptide sequence GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Deoxyribonuclease I; deoxyribonuclease IFLJ38093 deoxyribonuclease-1 DKFZp686H0155 DNase I DNase I lysosomal DNL1FLJ44902 Dornase alfa DRNI EC 3.1.21.1 human urine deoxyribonuclease I; Deoxyribonuclease-1; DNase I; DNase I, lysosomal; Dornase alfa; human urine deoxyribonuclease I
Gene Aliases: DNASE1; DNL1; DRNI
UniProt ID: (Human) P24855
Entrez Gene ID: (Human) 1773
Molecular Function:
actin family cytoskeletal protein
cytoskeletal protein
non-motor actin binding protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.