Novus Biologicals
Manufacturer Code:NBP154951
Catalog # NBP154951
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DNAJB6(DnaJ (Hsp40) homolog subfamily B member 6) The peptide sequence was selected from the N terminal of DNAJB6. Peptide sequence PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DJ4 DKFZp566D0824 DnaJ DnaJ (Hsp40) homolog subfamily B member 6 dnaJ homolog subfamily B member 6 DnaJ-like 2 protein FLJ42837 Heat shock protein J2 HHDJ1 HSJ2 HSJ-2 MGC1152 MRJMGC117297 MSJ1 MSJ-1; DnaJ (Hsp40) homolog, subfamily B, member 6; DnaJ homolog subfamily B member 6; DnaJ-like 2 protein; Heat shock protein J2; HHDJ1; HSJ-2; MRJ; MSJ-1
Gene Aliases: DJ4; DnaJ; DNAJB6; HHDJ1; HSJ-2; HSJ2; LGMD1D; LGMD1E; MRJ; MSJ-1; MSJ1
UniProt ID: (Human) O75190
Entrez Gene ID: (Human) 10049
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.