Novus Biologicals
Manufacturer Code:NBP258535
Catalog # NBP258535
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DnaJ (Hsp40) homolog subfamily B member 5 heat shock cognate 40 Heat shock protein cognate 40 Heat shock protein Hsp40-2 Heat shock protein Hsp40-3 HSC40 Hsc40dnaJ homolog subfamily B member 5 KIAA1045; DnaJ (Hsp40) homolog, subfamily B, member 5; DnaJ homolog subfamily B member 5; heat shock cognate 40; Heat shock protein cognate 40; Heat shock protein Hsp40-2; Heat shock protein Hsp40-3; Hsc40
Gene Aliases: DNAJB5; HSC40
UniProt ID: (Human) O75953
Entrez Gene ID: (Human) 25822
Molecular Function:
chaperone
chaperonin
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.