Novus Biologicals
Manufacturer Code:NBP190491
Catalog # NBP190491
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DEEKKLYLVHKTDEKGLVRDEMGRPILNAGVTTEGRPPLQVCQYWVPRIQLLFCAEDPCMFAQRVVQANALRKNTEALL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Axonemal beta dynein heavy chain 1; axonemal beta dynein heavy chain 1 axonemal heavy polypeptide 1 ciliary dynein heavy chain 1 DNAH1 variant protein DNAHC1 dynein heavy chain 1 axonemal dynein axonemal heavy chain 1 HDHC7 heat shock regulated 1 HL11 HL-11 HSRF-1; Ciliary dynein heavy chain 1; DNAH1 variant protein; Dynein heavy chain 1, axonemal; dynein, axonemal, heavy chain 1; dynein, axonemal, heavy polypeptide 1; hDHC7; Heat shock regulated protein 1; HSRF-1; testicular tissue protein Li 60
Gene Aliases: DHC7; DNAH1; DNAHC1; HDHC7; HL-11; HL11; HSRF-1; KIAA1410; XLHSRF-1
UniProt ID: (Human) Q9P2D7
Entrez Gene ID: (Human) 25981
Molecular Function:
cytoskeletal protein
hydrolase
microtubule binding motor protein
microtubule family cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.