Novus Biologicals
Manufacturer Code:NBP170428
Catalog # NBP170428
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C14ORF104 The peptide sequence was selected from the N terminal of C14ORF104. Peptide sequence MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: axonemal dynein axonemal assembly factor 2; dynein (axonemal) assembly factor 2; Dynein assembly factor 2, axonemal; dynein, axonemal, assembly factor 2; kintoun; Protein kintoun
Gene Aliases: C14orf104; CILD10; DNAAF2; KTU; PF13
UniProt ID: (Human) Q9NVR5
Entrez Gene ID: (Human) 55172
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.