Novus Biologicals
Manufacturer Code:NBP158159
Catalog # NBP158159
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to POLS(polymerase (DNA directed) sigma) The peptide sequence was selected from the N terminal of POLS. Peptide sequence VVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DNA polymerase kappa; DNA polymerase kappa DNA polymerase sigma EC 2.7.7.7 LAK-1TUTase 5 PAP associated domain containing 7 POLKTRF41 POLSTUTASE5 polymerase (DNA directed) sigma polymerase (DNA-directed) sigma Terminal uridylyltransferase 5 Topoisomerase-related function protein 4-1 TRF4-1LAK1 TRF4PAP-associated domain-containing protein 7; DNA polymerase sigma; LAK-1; Non-canonical poly(A) RNA polymerase PAPD7; PAP-associated domain-containing protein 7; polymerase (DNA directed) sigma; polymerase (DNA-directed) sigma; Terminal guanylyltransferase; Terminal nucleotidyltransferase 4A; Terminal uridylyltransferase 5; Topoisomerase-related function protein 4-1; TRAMP-like complex polyadenylate polymerase; TRF4-1; TUTase 5
Gene Aliases: LAK-1; LAK1; PAPD7; POLK; POLS; TENT4A; TRF4; TRF4-1; TRF41; TUTASE5
UniProt ID: (Human) Q5XG87
Entrez Gene ID: (Human) 11044
Molecular Function:
DNA binding protein
DNA methyltransferase
DNA-directed DNA polymerase
methyltransferase
nucleic acid binding
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.