Novus Biologicals
Manufacturer Code:NBP169268
Catalog # NBP169268
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DLL3(delta-like 3 (Drosophila)) The peptide sequence was selected from the N terminal of DLL3 (NP_058637). Peptide sequence MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: delta (Drosophila)-like 3 Delta3 delta-like 3 (Drosophila) delta-like protein 3 Drosophila Delta homolog 3 SCDO1delta3; delta-like 3; Delta-like protein 3; Delta3; Drosophila Delta homolog 3
Gene Aliases: DLL3; SCDO1
UniProt ID: (Human) Q9NYJ7
Entrez Gene ID: (Human) 10683
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.