Novus Biologicals
Manufacturer Code:NBP255221
Catalog # NBP255221
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CBF5 CBF5 homolog cbf5p homolog DKC dyskeratosis congenita 1 dyskerin Dyskerin EC 5.4.99 EC 5.4.99.- FLJ97620 H/ACA ribonucleoprotein complex subunit 4 NAP57 NOLA4dyskerin Nopp140-associated protein of 57 kDa Nucleolar protein family A member 4 Nucleolar protein NAP57 snoRNP protein DKC1 XAP101; CBF5 homolog; dyskeratosis congenita 1, dyskerin; Dyskerin; H/ACA ribonucleoprotein complex subunit DKC1; Nopp140-associated protein of 57 kDa; Nucleolar protein family A member 4; Nucleolar protein NAP57; snoRNP protein DKC1
Gene Aliases: CBF5; DKC; DKC1; DKCX; NAP57; NOLA4; XAP101
UniProt ID: (Human) O60832
Entrez Gene ID: (Human) 1736
Molecular Function:
DNA binding protein
centromere DNA-binding protein
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.