Novus Biologicals
Manufacturer Code:NBP256543
Catalog # NBP256543
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EWRRMLTSEGLRCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 5DII; 5DII D2 deiodinase iodothyronine type II DIOII EC 1.97.1 EC 1.97.1.10 ITDI2 SelY TXDI2thyroxine deiodinase type II Type 2 DI type 2 iodothyronine deiodinase type II iodothyronine deiodinase type-II 5'deiodinase Type-II 5'-deiodinase; deiodinase-2; deiodonase-2; DIOII; thyroxine deiodinase, type II; Type 2 DI; type 2 iodothyronine deiodinase; Type II iodothyronine deiodinase; Type-II 5'-deiodinase; type-II 5'deiodinase
Gene Aliases: 5DII; D2; DIO2; DIOII; ITDI2; SelY; TXDI2
UniProt ID: (Human) Q92813
Entrez Gene ID: (Human) 1734
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.