Novus Biologicals
Manufacturer Code:NBP185348
Catalog # NBP185348
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D11lgp2e D11LGP2probable ATP-dependent RNA helicase DHX58 DEXH (Asp-Glu-X-His) box polypeptide 58 EC 3.6.4.13 LGP2ortholog of mouse D11lgp2 Probable ATP-dependent helicase LGP2 Protein D11Lgp2 homolog RIG-I-like receptor LGP2 RLR RNA helicase LGP2; DEXH (Asp-Glu-X-His) box polypeptide 58; ortholog of mouse D11lgp2; Probable ATP-dependent helicase LGP2; Probable ATP-dependent RNA helicase DHX58; Protein D11Lgp2 homolog; RIG-I-like receptor 3; RIG-I-like receptor LGP2; RLR; RLR-3; RNA helicase LGP2
Gene Aliases: D11LGP2; D11LGP2E; DHX58; LGP2; RLR-3
UniProt ID: (Human) Q96C10
Entrez Gene ID: (Human) 79132
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.