Novus Biologicals
Manufacturer Code:NBP189379
Catalog # NBP189379
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-alpha hydroxysteroid dehydrogenase; 3-alpha-HSD; dehydrogenase/reductase (SDR family) member 9; dehydrogenase/reductase (SDR family) member 93alpha-HSD EC 1.1 EC 1.1.1 EC 1.1.1.105 member 43-alpha-HSD NADP-dependent retinol dehydrogenase/reductase RDH15 RDH-E2 RDHL3ALPHA-HSD RDHTBE; Dehydrogenase/reductase SDR family member 9; NADP-dependent retinol dehydrogenase/reductase; RDH-E2; RDH-TBE; RDHL; Retinol dehydrogenase 15; retinol dehydrogenase homolog; Short chain dehydrogenase/reductase family 9C member 4; short chain dehydrogenase/reductase family 9C, member 4; Short-chain dehydrogenase/reductase retSDR8; Tracheobronchial epithelial cell-specific retinol dehydrogenase
Gene Aliases: 3-alpha-HSD; 3ALPHA-HSD; DHRS9; RDH-E2; RDH-TBE; RDH15; RDHL; RDHTBE; RETSDR8; SDR9C4; UNQ835/PRO1773
UniProt ID: (Human) Q9BPW9
Entrez Gene ID: (Human) 10170
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.