Novus Biologicals
Manufacturer Code:NBP168913
Catalog # NBP168913
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to Dhrs7 (dehydrogenase/reductase (SDR family) member 7) The peptide sequence was selected from the N terminal of Dhrs7. Peptide sequence MVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dehydrogenase/reductase (SDR family) member 7; dehydrogenase/reductase (SDR family) member 72310016E22Rik dehydrogenase/reductase SDR family member 7 DHRS7A EC 1.1 retDSR4 Retinal short-chain dehydrogenase/reductase 4 RETSDR4 SDR34C1 short chain dehydrogenase/reductase family 34C member 1; Dehydrogenase/reductase SDR family member 7; Retinal short-chain dehydrogenase/reductase 4; retSDR4; Short chain dehydrogenase/reductase family 34C member 1; short chain dehydrogenase/reductase family 34C, member 1
Gene Aliases: CGI-86; DHRS7; DHRS7A; retDSR4; RETSDR4; SDR34C1; UNQ285/PRO3448
UniProt ID: (Human) Q9Y394
Entrez Gene ID: (Human) 51635
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.