Novus Biologicals
Manufacturer Code:NBP191831
Catalog # NBP191831
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-deoxyglucosone reductase; 3-deoxyglucosone reductase dihydrodiol dehydrogenase (dimeric) Dimeric dihydrodiol dehydrogenase D-xylose 1-dehydrogenase D-xylose-NADP dehydrogenase EC 1.1.1.1792DD EC 1.3.1.20 Hum2DD trans-12-dihydrobenzene-12-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; dihydrodiol dehydrogenase (dimeric); Dimeric dihydrodiol dehydrogenase; Hum2DD; Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
Gene Aliases: 2DD; DHDH; HUM2DD
UniProt ID: (Human) Q9UQ10
Entrez Gene ID: (Human) 27294
Molecular Function: dehydrogenase oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.