Novus Biologicals
Manufacturer Code:NBP180740
Catalog # NBP180740
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:HQKDLFRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 7-dehydrocholesterol reductase; 7-dehydrocholesterol reductase 7-DHC reductase D7SR delta-7-dehydrocholesterol reductase EC 1.3.1 EC 1.3.1.21 Putative sterol reductase SR-2 SLOS Smith-Lemli-Opitz syndrome Sterol Delta(7)-reductase sterol delta-7-reductase; 7-DHC reductase; delta-7-dehydrocholesterol reductase; Delta7-sterol reductase; putative sterol reductase SR-2; Sterol Delta(7)-reductase; sterol delta-7-reductase; Sterol reductase SR-2
Gene Aliases: D7SR; DHCR7; SLOS
UniProt ID: (Human) Q9UBM7
Entrez Gene ID: (Human) 1717
Molecular Function:
oxidoreductase
receptor
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.