Novus Biologicals
Manufacturer Code:NBP155325
Catalog # NBP155325
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DENND1A(DENN/MADD domain containing 1A) Antibody(against the N terminal of DENND1A (NP_065997). Peptide sequence PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Connecdenn; Connecdenn 1; Connecdenn Connecdenn 1 DENN/MADD domain containing 1A FAM31ADENN domain-containing protein 1A FLJ21129 FLJ38464 KIAA1608connecdenn Protein FAM31A RP11-230L22.3; DENN domain-containing protein 1A; DENN/MADD domain containing 1A; Protein FAM31A
Gene Aliases: DENND1A; FAM31A; KIAA1608
UniProt ID: (Human) Q8TEH3
Entrez Gene ID: (Human) 57706
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.