Novus Biologicals
Manufacturer Code:NBP159941
Catalog # NBP159941
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DEGS1(degenerative spermatocyte homolog 1 lipid desaturase (Drosophila)) The peptide sequence was selected from the N terminal of DEGS1 (NP_003667). Peptide sequence GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIM |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cell migration-inducing gene 15 protein; Cell migration-inducing gene 15 protein Degenerative spermatocyte homolog 1 degenerative spermatocyte homolog 1 lipid desaturase (Drosophila) degenerative spermatocyte homolog lipid desaturase (Drosophila) DEGS Des-1 DES1degenerative spermatocyte homolog lipid desaturase EC 1.14 FADS7 membrane fatty acid (lipid) desaturase Membrane lipid desaturase MGC5079 migration-inducing gene 15 protein MLDdihydroceramide desaturase sphingolipid delta 4 desaturase sphingolipid delta(4)-desaturase DES1; Degenerative spermatocyte homolog 1; degenerative spermatocyte homolog 1, lipid desaturase; degenerative spermatocyte homolog, lipid desaturase; delta(4)-desaturase, sphingolipid 1; dihydroceramide desaturase 1; Dihydroceramide desaturase-1; membrane fatty acid (lipid) desaturase; Membrane lipid desaturase; migration-inducing gene 15 protein; sphingolipid delta 4 desaturase; sphingolipid delta(4)-desaturase 1; Sphingolipid delta(4)-desaturase DES1
Gene Aliases: DEGS; DEGS-1; DEGS1; Des-1; DES1; FADS7; MIG15; MLD
UniProt ID: (Human) O15121
Entrez Gene ID: (Human) 8560
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.