Novus Biologicals
Manufacturer Code:NBP181618
Catalog # NBP181618
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DEF-6; DEF-6 differentially expressed in FDCP 6 homolog differentially expressed in FDCP 6 homolog (mouse) IBPdifferentially expressed in FDCP (mouse homolog) 6 IRF4-binding protein SLAT SWAP70L SWAP-70-like adaptor protein of T cells; DEF6 guanine nucleotide exchange factor; Differentially expressed in FDCP 6 homolog; IRF4-binding protein; SWAP-70-like adaptor protein of T cells
Gene Aliases: DEF6; IBP; SLAT; SWAP70L
UniProt ID: (Human) Q9H4E7
Entrez Gene ID: (Human) 50619
Molecular Function:
calcium-binding protein
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.