Novus Biologicals
Manufacturer Code:NBP153172
Catalog # NBP153172
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to DECR2(24-dienoyl CoA reductase 2 peroxisomal) The peptide sequence was selected from the N terminal of DECR2. Peptide sequence MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2,4-dienoyl CoA reductase 2, peroxisomal; 2,4-dienoyl-CoA reductase 2; 24-dienoyl CoA reductase 2 peroxisomal EC 1.3.1 EC 1.3.1.34 pDCR24-dienoyl-CoA reductase 2 PDCRshort chain dehydrogenase/reductase family 17C member 1 peroxisomal 24-dienoyl-CoA reductase SDR17C1; pDCR; Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]; Short chain dehydrogenase/reductase family 17C member 1; short chain dehydrogenase/reductase family 17C, member 1
Gene Aliases: DECR2; PDCR; SDR17C1
UniProt ID: (Human) Q9NUI1
Entrez Gene ID: (Human) 26063
Molecular Function: dehydrogenase oxidoreductase reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.