Novus Biologicals
Manufacturer Code:NBP185264
Catalog # NBP185264
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial; 2,4-dienoyl-CoA reductase [NADPH]; 24-dienoyl CoA reductase 1 mitochondrial 4-enoyl-CoA reductase 4-enoyl-CoA reductase [NADPH] DECR DECR24-dienoyl-CoA reductase [NADPH]24-dienoyl-CoA reductase mitochondrial EC 1.3.1.34 NADPH SDR18C1 short chain dehydrogenase/reductase family 18C member 1; 4-enoyl-CoA reductase; 4-enoyl-CoA reductase [NADPH]; Short chain dehydrogenase/reductase family 18C member 1; short chain dehydrogenase/reductase family 18C, member 1
Gene Aliases: DECR; DECR1; NADPH; SDR18C1
UniProt ID: (Human) Q16698
Entrez Gene ID: (Human) 1666
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.