Novus Biologicals
Manufacturer Code:NBP247489
Catalog # NBP247489
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCIKQGENWYSPTE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DEAF1 transcription factor; deformed epidermal autoregulatory factor 1 (Drosophila) Nuclear DEAF-1-related transcriptional regulator NUDRdeformed epidermal autoregulatory factor 1 homolog SPNsuppressin Zinc finger MYND domain-containing protein 5 ZMYND5Suppressin; Deformed epidermal autoregulatory factor 1 homolog; Nuclear DEAF-1-related transcriptional regulator; NUDR; Suppressin; Zinc finger MYND domain-containing protein 5
Gene Aliases: DEAF1; MRD24; NUDR; SPN; ZMYND5
UniProt ID: (Human) O75398
Entrez Gene ID: (Human) 10522
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.