Novus Biologicals
Manufacturer Code:NBP238311
Catalog # NBP238311
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DEAD (Asp-Glu-Ala-Asp) box helicase 21; DEAD (Asp-Glu-Ala-Asp) box polypeptide 21; DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 DEAD box protein 21 DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21 DKFZp686F21172 EC 3.6.1 EC 3.6.4.13 Gu protein GUA gu-alpha GURDB nucleolar RNA helicase 2 Nucleolar RNA helicase Gu Nucleolar RNA helicase II RH II/Gu RH-II/GU RH-II/GuA RNA helicase II/Gu alpha; DEAD box protein 21; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21; Gu protein; Gu-alpha; Nucleolar RNA helicase 2; Nucleolar RNA helicase Gu; Nucleolar RNA helicase II; RH II/Gu; RNA helicase II/Gu alpha
Gene Aliases: DDX21; GUA; GURDB; RH-II/GU; RH-II/GuA
UniProt ID: (Human) Q9NR30
Entrez Gene ID: (Human) 9188
Molecular Function:
RNA binding protein
RNA helicase
helicase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.