Novus Biologicals
Manufacturer Code:NBP238985
Catalog # NBP238985
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DEAD (Asp-Glu-Ala-Asp) box helicase 17; DEAD (Asp-Glu-Ala-Asp) box polypeptide 17; DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 DEAD box protein 17 DEAD box protein p72 DEAD/H box 17 DKFZp761H2016 EC 3.6.1 EC 3.6.4.13 P72DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD) probable ATP-dependent RNA helicase DDX17 RH70 RNA-dependent helicase p72; DEAD box protein 17; DEAD box protein p72; DEAD box protein p82; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD); Probable ATP-dependent RNA helicase DDX17; RNA-dependent helicase p72
Gene Aliases: DDX17; P72; RH70
UniProt ID: (Human) Q92841
Entrez Gene ID: (Human) 10521
Molecular Function:
RNA binding protein
RNA helicase
helicase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.